SEC14L2 MaxPab mouse polyclonal antibody (B01) View larger

SEC14L2 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SEC14L2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about SEC14L2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00023541-B01
Product name: SEC14L2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human SEC14L2 protein.
Gene id: 23541
Gene name: SEC14L2
Gene alias: C22orf6|KIAA1186|KIAA1658|MGC65053|SPF|TAP|TAP1
Gene description: SEC14-like 2 (S. cerevisiae)
Genbank accession: BC058915.1
Immunogen: SEC14L2 (AAH58915.1, 1 a.a. ~ 392 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDNIISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLKTKMGERQRAGEMTEVLPNQRYNSHLVPEDGTLTCSDPGICKYLCLGNALKPHVQLSACEVPLPPWIFGSEC
Protein accession: AAH58915.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023541-B01-13-15-1.jpg
Application image note: Western Blot analysis of SEC14L2 expression in transfected 293T cell line (H00023541-T01) by SEC14L2 MaxPab polyclonal antibody.

Lane 1: SEC14L2 transfected lysate(43.12 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SEC14L2 MaxPab mouse polyclonal antibody (B01) now

Add to cart