Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CLCF1 purified MaxPab mouse polyclonal antibody (B03P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about CLCF1 purified MaxPab mouse polyclonal antibody (B03P)
| Brand: | Abnova |
| Reference: | H00023529-B03P |
| Product name: | CLCF1 purified MaxPab mouse polyclonal antibody (B03P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human CLCF1 protein. |
| Gene id: | 23529 |
| Gene name: | CLCF1 |
| Gene alias: | BSF3|CISS2|CLC|NNT1|NR6 |
| Gene description: | cardiotrophin-like cytokine factor 1 |
| Genbank accession: | NM_013246 |
| Immunogen: | CLCF1 (NP_037378.1, 1 a.a. ~ 225 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MDLRAGDSWGMLACLCTVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF |
| Protein accession: | NP_037378.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CLCF1 expression in transfected 293T cell line (H00023529-T05) by CLCF1 MaxPab polyclonal antibody. Lane 1: CLCF1 transfected lysate(25.20 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |