CLCF1 purified MaxPab mouse polyclonal antibody (B03P) View larger

CLCF1 purified MaxPab mouse polyclonal antibody (B03P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLCF1 purified MaxPab mouse polyclonal antibody (B03P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CLCF1 purified MaxPab mouse polyclonal antibody (B03P)

Brand: Abnova
Reference: H00023529-B03P
Product name: CLCF1 purified MaxPab mouse polyclonal antibody (B03P)
Product description: Mouse polyclonal antibody raised against a full-length human CLCF1 protein.
Gene id: 23529
Gene name: CLCF1
Gene alias: BSF3|CISS2|CLC|NNT1|NR6
Gene description: cardiotrophin-like cytokine factor 1
Genbank accession: NM_013246
Immunogen: CLCF1 (NP_037378.1, 1 a.a. ~ 225 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDLRAGDSWGMLACLCTVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF
Protein accession: NP_037378.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023529-B03P-13-15-1.jpg
Application image note: Western Blot analysis of CLCF1 expression in transfected 293T cell line (H00023529-T05) by CLCF1 MaxPab polyclonal antibody.

Lane 1: CLCF1 transfected lysate(25.20 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CLCF1 purified MaxPab mouse polyclonal antibody (B03P) now

Add to cart