Brand: | Abnova |
Reference: | H00023526-M06 |
Product name: | HMHA1 monoclonal antibody (M06), clone 4H7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HMHA1. |
Clone: | 4H7 |
Isotype: | IgG2a Kappa |
Gene id: | 23526 |
Gene name: | HMHA1 |
Gene alias: | HA-1|HLA-HA1|KIAA0223 |
Gene description: | histocompatibility (minor) HA-1 |
Genbank accession: | BC065223 |
Immunogen: | HMHA1 (AAH65223.1, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HRSPLTAASPGELPTEGAGPDVVEDISHLLADVARFAEGLEKLKECVLHDDLLEARRPRAHECLGEALRVMHQIISKYPLLNTVETLTAAGTLIAKVKAF |
Protein accession: | AAH65223.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | HMHA1 monoclonal antibody (M06), clone 4H7. Western Blot analysis of HMHA1 expression in Raw 264.7. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |