Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DAAM2 monoclonal antibody (M01), clone 1D8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about DAAM2 monoclonal antibody (M01), clone 1D8
| Reference: | H00023500-M01 |
| Product name: | DAAM2 monoclonal antibody (M01), clone 1D8 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant DAAM2. |
| Clone: | 1D8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23500 |
| Gene name: | DAAM2 |
| Gene alias: | KIAA0381|MGC90515|dJ90A20A.1 |
| Gene description: | dishevelled associated activator of morphogenesis 2 |
| Genbank accession: | BC047575.1 |
| Immunogen: | DAAM2 (AAH47575.1, 1 a.a. ~ 132 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAPRKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAELVDELDLTDKNREAMFALPPEKKWQIYCSKKKVPSLTPLATSQGSWHGVALAALACSCIHLMFITCQPCSRCWRNNSE |
| Protein accession: | AAH47575.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |