Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MACF1 monoclonal antibody (M01), clone 6G7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about MACF1 monoclonal antibody (M01), clone 6G7
| Brand: | Abnova |
| Reference: | H00023499-M01 |
| Product name: | MACF1 monoclonal antibody (M01), clone 6G7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MACF1. |
| Clone: | 6G7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 23499 |
| Gene name: | MACF1 |
| Gene alias: | ABP620|ACF7|FLJ45612|FLJ46776|KIAA0465|KIAA1251|MACF|OFC4 |
| Gene description: | microtubule-actin crosslinking factor 1 |
| Genbank accession: | BC007330 |
| Immunogen: | MACF1 (AAH07330, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGASQGMTPF |
| Protein accession: | AAH07330 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MACF1 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Laminin-based cell adhesion anchors microtubule plus ends to the epithelial cell basal cortex through LL5{alpha}/{beta}.Hotta A, Kawakatsu T, Nakatani T, Sato T, Matsui C, Sukezane T, Akagi T, Hamaji T, Grigoriev I, Akhmanova A, Takai Y, Mimori-Kiyosue Y. J Cell Biol. 2010 May 31;189(5):901-17. |