Brand: | Abnova |
Reference: | H00023495-M16 |
Product name: | TNFRSF13B monoclonal antibody (M16), clone 1B5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF13B. |
Clone: | 1B5 |
Isotype: | IgG1 Kappa |
Gene id: | 23495 |
Gene name: | TNFRSF13B |
Gene alias: | CD267|CVID|FLJ39942|MGC133214|MGC39952|TACI|TNFRSF14B |
Gene description: | tumor necrosis factor receptor superfamily, member 13B |
Genbank accession: | NM_012452 |
Immunogen: | TNFRSF13B (NP_036584.1, 2 a.a. ~ 165 a.a) partial recombinant protein. |
Immunogen sequence/protein sequence: | SGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYS |
Protein accession: | NP_036584.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (20.24 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |