TNFRSF13B monoclonal antibody (M14), clone 1G1 View larger

TNFRSF13B monoclonal antibody (M14), clone 1G1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNFRSF13B monoclonal antibody (M14), clone 1G1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TNFRSF13B monoclonal antibody (M14), clone 1G1

Brand: Abnova
Reference: H00023495-M14
Product name: TNFRSF13B monoclonal antibody (M14), clone 1G1
Product description: Mouse monoclonal antibody raised against a partial recombinant TNFRSF13B.
Clone: 1G1
Isotype: IgG1 Kappa
Gene id: 23495
Gene name: TNFRSF13B
Gene alias: CD267|CVID|FLJ39942|MGC133214|MGC39952|TACI|TNFRSF14B
Gene description: tumor necrosis factor receptor superfamily, member 13B
Genbank accession: NM_012452
Immunogen: TNFRSF13B (NP_036584.1, 2 a.a. ~ 165 a.a) partial recombinant protein.
Immunogen sequence/protein sequence: SGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYS
Protein accession: NP_036584.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023495-M14-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (20.24 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TNFRSF13B monoclonal antibody (M14), clone 1G1 now

Add to cart