HEY2 monoclonal antibody (M02), clone 2B10 View larger

HEY2 monoclonal antibody (M02), clone 2B10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HEY2 monoclonal antibody (M02), clone 2B10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,S-ELISA,ELISA,WB-Re

More info about HEY2 monoclonal antibody (M02), clone 2B10

Brand: Abnova
Reference: H00023493-M02
Product name: HEY2 monoclonal antibody (M02), clone 2B10
Product description: Mouse monoclonal antibody raised against a partial recombinant HEY2.
Clone: 2B10
Isotype: IgG2a Kappa
Gene id: 23493
Gene name: HEY2
Gene alias: CHF1|GRIDLOCK|GRL|HERP1|HESR2|HRT2|MGC10720|bHLHb32
Gene description: hairy/enhancer-of-split related with YRPW motif 2
Genbank accession: NM_012259
Immunogen: HEY2 (NP_036391.1, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKG
Protein accession: NP_036391.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023493-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023493-M02-2-A7-1.jpg
Application image note: HEY2 monoclonal antibody (M02), clone 2B10. Western Blot analysis of HEY2 expression in human pancreas.
Applications: WB-Ti,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HEY2 monoclonal antibody (M02), clone 2B10 now

Add to cart