Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NIFUN purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about NIFUN purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00023479-B01P |
| Product name: | NIFUN purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human NIFUN protein. |
| Gene id: | 23479 |
| Gene name: | ISCU |
| Gene alias: | 2310020H20Rik|HML|ISU2|MGC74517|NIFU|NIFUN|hnifU |
| Gene description: | iron-sulfur cluster scaffold homolog (E. coli) |
| Genbank accession: | NM_014301 |
| Immunogen: | NIFUN (NP_055116, 1 a.a. ~ 142 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MVLIDMSVDLSTQVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK |
| Protein accession: | NP_055116 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ISCU expression in transfected 293T cell line (H00023479-T01) by ISCU MaxPab polyclonal antibody. Lane 1: NIFUN transfected lysate(15.62 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |