CBX5 MaxPab mouse polyclonal antibody (B01) View larger

CBX5 MaxPab mouse polyclonal antibody (B01)

H00023468-B01_50uL

New product

395,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CBX5 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,WB-Tr

More info about CBX5 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00023468-B01
Product name: CBX5 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human CBX5 protein.
Gene id: 23468
Gene name: CBX5
Gene alias: HP1|HP1A
Gene description: chromobox homolog 5 (HP1 alpha homolog, Drosophila)
Genbank accession: NM_012117.1
Immunogen: CBX5 (NP_036249.1, 1 a.a. ~ 191 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS
Protein accession: NP_036249.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023468-B01-13-15-1.jpg
Application image note: Western Blot analysis of CBX5 expression in transfected 293T cell line (H00023468-T01) by CBX5 MaxPab polyclonal antibody.

Lane 1: CBX5 transfected lysate(21.01 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CBX5 MaxPab mouse polyclonal antibody (B01) now

Add to cart