Brand: | Abnova |
Reference: | H00023463-A01 |
Product name: | ICMT polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant ICMT. |
Gene id: | 23463 |
Gene name: | ICMT |
Gene alias: | HSTE14|MGC39955|MST098|MSTP098|PCCMT|PCMT|PPMT |
Gene description: | isoprenylcysteine carboxyl methyltransferase |
Genbank accession: | NM_012405 |
Immunogen: | ICMT (NP_036537, 86 a.a. ~ 154 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | SQSSWSHFGWYMCSLSLFHYSEYLVTAVNNPKSLSLDSFLLNHSLEYTVAALSSWLEFTLENIFWPELK |
Protein accession: | NP_036537 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.7 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |