HEY1 monoclonal antibody (M08), clone 3G10 View larger

HEY1 monoclonal antibody (M08), clone 3G10

H00023462-M08_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HEY1 monoclonal antibody (M08), clone 3G10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about HEY1 monoclonal antibody (M08), clone 3G10

Brand: Abnova
Reference: H00023462-M08
Product name: HEY1 monoclonal antibody (M08), clone 3G10
Product description: Mouse monoclonal antibody raised against a partial recombinant HEY1.
Clone: 3G10
Isotype: IgG2a Kappa
Gene id: 23462
Gene name: HEY1
Gene alias: BHLHb31|CHF2|HERP2|HESR1|HRT-1|MGC1274|OAF1
Gene description: hairy/enhancer-of-split related with YRPW motif 1
Genbank accession: NM_012258
Immunogen: HEY1 (NP_036390, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLG
Protein accession: NP_036390
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023462-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023462-M08-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged HEY1 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HEY1 monoclonal antibody (M08), clone 3G10 now

Add to cart