Brand: | Abnova |
Reference: | H00023462-M07 |
Product name: | HEY1 monoclonal antibody (M07), clone 4B3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HEY1. |
Clone: | 4B3 |
Isotype: | IgG2a Kappa |
Gene id: | 23462 |
Gene name: | HEY1 |
Gene alias: | BHLHb31|CHF2|HERP2|HESR1|HRT-1|MGC1274|OAF1 |
Gene description: | hairy/enhancer-of-split related with YRPW motif 1 |
Genbank accession: | NM_012258 |
Immunogen: | HEY1 (NP_036390, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLG |
Protein accession: | NP_036390 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00023462-M07-9-21-1.jpg](http://www.abnova.com/application_image/H00023462-M07-9-21-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged HEY1 is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |