Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HEY1 monoclonal antibody (M02), clone 2F10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about HEY1 monoclonal antibody (M02), clone 2F10
| Brand: | Abnova |
| Reference: | H00023462-M02 |
| Product name: | HEY1 monoclonal antibody (M02), clone 2F10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HEY1. |
| Clone: | 2F10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23462 |
| Gene name: | HEY1 |
| Gene alias: | BHLHb31|CHF2|HERP2|HESR1|HRT-1|MGC1274|OAF1 |
| Gene description: | hairy/enhancer-of-split related with YRPW motif 1 |
| Genbank accession: | NM_012258 |
| Immunogen: | HEY1 (NP_036390, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLG |
| Protein accession: | NP_036390 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of HEY1 expression in transfected 293T cell line by HEY1 monoclonal antibody (M02), clone 2F10. Lane 1: HEY1 transfected lysate(32.613 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Role of HERP and a HERP-related protein in HRD1-dependent protein degradation at the endoplasmic reticulum.Huang CH, Chu YR, Ye Y, Chen X J Biol Chem. 2013 Dec 23. |