Brand: | Abnova |
Reference: | H00023460-M01 |
Product name: | ABCA6 monoclonal antibody (M01), clone 2F1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ABCA6. |
Clone: | 2F1 |
Isotype: | IgG1 Kappa |
Gene id: | 23460 |
Gene name: | ABCA6 |
Gene alias: | EST155051|FLJ43498 |
Gene description: | ATP-binding cassette, sub-family A (ABC1), member 6 |
Genbank accession: | NM_080284 |
Immunogen: | ABCA6 (NP_525023, 53 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NVQFPGMAPQNLGRVDKFNSSSLMVVYTPISNLTQQIMNKTALAPLLKGTSVIGAPNKTHMDEILLENLPYAMGIIFNETFSYKLIFFQGYNSPLWK |
Protein accession: | NP_525023 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00023460-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00023460-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00023460-M01-9-18-1.jpg](http://www.abnova.com/application_image/H00023460-M01-9-18-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged ABCA6 is 3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |