Brand: | Abnova |
Reference: | H00023450-Q01 |
Product name: | SF3B3 (Human) Recombinant Protein (Q01) |
Product description: | Human SF3B3 partial ORF ( NP_036558.3, 819 a.a. - 929 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 23450 |
Gene name: | SF3B3 |
Gene alias: | KIAA0017|RSE1|SAP130|SF3b130|STAF130 |
Gene description: | splicing factor 3b, subunit 3, 130kDa |
Genbank accession: | NM_012426 |
Immunogen sequence/protein sequence: | MAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYK |
Protein accession: | NP_036558.3 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: |  |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Human albumin attenuates excessive innate immunity via inhibition of microglial Mincle/Syk signaling in subarachnoid hemorrhage.Xie Y, Guo H, Wang L, Xu L, Zhang X, Yu L, Liu Q, Li Y, Zhao N, Zhao N, Ye R, Liu X Brain Behav Immun. 2016 Nov 11. [Epub ahead of print] |