Brand: | Abnova |
Reference: | H00023443-M01 |
Product name: | SLC35A3 monoclonal antibody (M01), clone 4B6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC35A3. |
Clone: | 4B6 |
Isotype: | IgG2a Kappa |
Gene id: | 23443 |
Gene name: | SLC35A3 |
Gene alias: | DKFZp781P1297 |
Gene description: | solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member A3 |
Genbank accession: | NM_012243 |
Immunogen: | SLC35A3 (NP_036375, 61 a.a. ~ 113 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DSKCSLRALNRVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATY |
Protein accession: | NP_036375 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00023443-M01-1-7-1.jpg](http://www.abnova.com/application_image/H00023443-M01-1-7-1.jpg) |
Application image note: | SLC35A3 monoclonal antibody (M01), clone 4B6 Western Blot analysis of SLC35A3 expression in MCF-7 ( Cat # L046V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA |
Shipping condition: | Dry Ice |