ELA3B (Human) Recombinant Protein (P02) View larger

ELA3B (Human) Recombinant Protein (P02)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ELA3B (Human) Recombinant Protein (P02)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about ELA3B (Human) Recombinant Protein (P02)

Brand: Abnova
Reference: H00023436-P02
Product name: ELA3B (Human) Recombinant Protein (P02)
Product description: Human ELA3B full-length ORF (AAH05216, 1 a.a. - 270 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 23436
Gene name: ELA3B
Gene alias: -
Gene description: elastase 3B, pancreatic
Genbank accession: BC005216
Immunogen sequence/protein sequence: MMLRLLSSPLLVAVASGYGPPSSRPSSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSWTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH
Protein accession: AAH05216
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue
Quality control testing picture: qc_test-H00023436-P02-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ELA3B (Human) Recombinant Protein (P02) now

Add to cart