Brand: | Abnova |
Reference: | H00023435-M02 |
Product name: | TARDBP monoclonal antibody (M02), clone 1B4-B1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TARDBP. |
Clone: | 1B4-B1 |
Isotype: | IgG1 Kappa |
Gene id: | 23435 |
Gene name: | TARDBP |
Gene alias: | ALS10|TDP-43 |
Gene description: | TAR DNA binding protein |
Genbank accession: | NM_007375.3 |
Immunogen: | TARDBP (NP_031401.1, 1 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA |
Protein accession: | NP_031401.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00023435-M02-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00023435-M02-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (54.34 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00023435-M02-9-20-1.jpg](http://www.abnova.com/application_image/H00023435-M02-9-20-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged TARDBP is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |