TARDBP monoclonal antibody (M02), clone 1B4-B1 View larger

TARDBP monoclonal antibody (M02), clone 1B4-B1

H00023435-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TARDBP monoclonal antibody (M02), clone 1B4-B1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TARDBP monoclonal antibody (M02), clone 1B4-B1

Brand: Abnova
Reference: H00023435-M02
Product name: TARDBP monoclonal antibody (M02), clone 1B4-B1
Product description: Mouse monoclonal antibody raised against a partial recombinant TARDBP.
Clone: 1B4-B1
Isotype: IgG1 Kappa
Gene id: 23435
Gene name: TARDBP
Gene alias: ALS10|TDP-43
Gene description: TAR DNA binding protein
Genbank accession: NM_007375.3
Immunogen: TARDBP (NP_031401.1, 1 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA
Protein accession: NP_031401.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023435-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (54.34 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023435-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged TARDBP is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TARDBP monoclonal antibody (M02), clone 1B4-B1 now

Add to cart