RHOQ purified MaxPab mouse polyclonal antibody (B01P) View larger

RHOQ purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RHOQ purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about RHOQ purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00023433-B01P
Product name: RHOQ purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human RHOQ protein.
Gene id: 23433
Gene name: RHOQ
Gene alias: ARHQ|RASL7A|TC10|TC10A
Gene description: ras homolog gene family, member Q
Genbank accession: NM_012249.3
Immunogen: RHOQ (NP_036381.2, 1 a.a. ~ 205 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAHGPGALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLGLYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKRIGSRCINCCLIT
Protein accession: NP_036381.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023433-B01P-4-1-1-L.jpg
Application image note: Immunofluorescence of purified MaxPab antibody to RHOQ on HeLa cell. [antibody concentration 10 ug/ml]
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RHOQ purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart