GPR161 monoclonal antibody (M01), clone 1B2 View larger

GPR161 monoclonal antibody (M01), clone 1B2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GPR161 monoclonal antibody (M01), clone 1B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GPR161 monoclonal antibody (M01), clone 1B2

Brand: Abnova
Reference: H00023432-M01
Product name: GPR161 monoclonal antibody (M01), clone 1B2
Product description: Mouse monoclonal antibody raised against a partial recombinant GPR161.
Clone: 1B2
Isotype: IgG2a Kappa
Gene id: 23432
Gene name: GPR161
Gene alias: FLJ33952|RE2
Gene description: G protein-coupled receptor 161
Genbank accession: NM_153832
Immunogen: GPR161 (NP_722561.1, 362 a.a. ~ 460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLEDYTSDDNPPSHCTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLD
Protein accession: NP_722561.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023432-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023432-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged GPR161 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GPR161 monoclonal antibody (M01), clone 1B2 now

Add to cart