Brand: | Abnova |
Reference: | H00023412-M01 |
Product name: | COMMD3 monoclonal antibody (M01), clone 2E2 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant COMMD3. |
Clone: | 2E2 |
Isotype: | IgG2a Kappa |
Gene id: | 23412 |
Gene name: | COMMD3 |
Gene alias: | BUP|C10orf8|DKFZp686K0399|FLJ45471 |
Gene description: | COMM domain containing 3 |
Genbank accession: | BC022898 |
Immunogen: | COMMD3 (AAH22898, 1 a.a. ~ 195 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MELSESVQKGFQMLADPRSFDSNAFTLLLRAAFQSLLDAQADEAVLDHPDLKHIDPVVLKHCHAAAATYILEAGKHRADKSTLSTYLEDCKFDRERIELFCTEYQNNKNSLEILLGSIGRSLPHITDVSWRLEYQIKTNQLHRMYRPAYLVTLSVQNTDSPSYPEISFSCSMEQLQDLVGKLKDASKSLERATQS |
Protein accession: | AAH22898 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged COMMD3 is 0.1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |