COMMD3 purified MaxPab mouse polyclonal antibody (B01P) View larger

COMMD3 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of COMMD3 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about COMMD3 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00023412-B01P
Product name: COMMD3 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human COMMD3 protein.
Gene id: 23412
Gene name: COMMD3
Gene alias: BUP|C10orf8|DKFZp686K0399|FLJ45471
Gene description: COMM domain containing 3
Genbank accession: NM_012071.2
Immunogen: COMMD3 (NP_036203.1, 1 a.a. ~ 195 a.a) full-length human protein.
Immunogen sequence/protein sequence: MELSESVQKGFQMLADPRSFDSNAFTLLLRAAFQSLLDAQADEAVLDHPDLKHIDPVVLKHCHAAAATYILEAGKHRADKSTLSTYLEDCKFDRERIELFCTEYQNNKNSLEILLGSIGRSLPHITDVSWRLEYQIKTNQLHRMYRPAYLVTLSVQNTDSPSYPEISFSCSMEQLQDLVGKLKDASKSLERATQL
Protein accession: NP_036203.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023412-B01P-13-15-1.jpg
Application image note: Western Blot analysis of COMMD3 expression in transfected 293T cell line (H00023412-T01) by COMMD3 MaxPab polyclonal antibody.

Lane 1: COMMD3 transfected lysate(21.45 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy COMMD3 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart