SIRT5 MaxPab mouse polyclonal antibody (B01) View larger

SIRT5 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SIRT5 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about SIRT5 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00023408-B01
Product name: SIRT5 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human SIRT5 protein.
Gene id: 23408
Gene name: SIRT5
Gene alias: FLJ36950|SIR2L5
Gene description: sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae)
Genbank accession: NM_012241.2
Immunogen: SIRT5 (NP_036373.1, 1 a.a. ~ 310 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS
Protein accession: NP_036373.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023408-B01-13-15-1.jpg
Application image note: Western Blot analysis of SIRT5 expression in transfected 293T cell line (H00023408-T01) by SIRT5 MaxPab polyclonal antibody.

Lane 1: SIRT5 transfected lysate(34.1 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SIRT5 MaxPab mouse polyclonal antibody (B01) now

Add to cart