DICER1 monoclonal antibody (M01), clone 2F12 View larger

DICER1 monoclonal antibody (M01), clone 2F12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DICER1 monoclonal antibody (M01), clone 2F12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about DICER1 monoclonal antibody (M01), clone 2F12

Brand: Abnova
Reference: H00023405-M01
Product name: DICER1 monoclonal antibody (M01), clone 2F12
Product description: Mouse monoclonal antibody raised against a partial recombinant DICER1.
Clone: 2F12
Isotype: IgG1 Kappa
Gene id: 23405
Gene name: DICER1
Gene alias: DCR1|Dicer|HERNA|KIAA0928
Gene description: dicer 1, ribonuclease type III
Genbank accession: NM_177438
Immunogen: DICER1 (NP_803187, 1813 a.a. ~ 1912 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSL
Protein accession: NP_803187
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023405-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023405-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged DICER1 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DICER1 monoclonal antibody (M01), clone 2F12 now

Add to cart