FRAT2 MaxPab mouse polyclonal antibody (B01) View larger

FRAT2 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FRAT2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about FRAT2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00023401-B01
Product name: FRAT2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human FRAT2 protein.
Gene id: 23401
Gene name: FRAT2
Gene alias: MGC10562
Gene description: frequently rearranged in advanced T-cell lymphomas 2
Genbank accession: BC020165
Immunogen: FRAT2 (AAH20165.1, 1 a.a. ~ 233 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPCRREEEEEAGEEAEGEEEEDDSFLLLQQSVTLGSSGEVDRLVAQIGETLQLDAAQDSPASPCAPPGVPLRAPGPLAAAVPTDKARPPAVPLLLPPASAETVGPAPSGALRCALGDRGRVRGRAAPYCVAEVAAGPSALPGPCRRGWLRDAVTSRRLQQRRWTQAGARAGDDDPHRLLQQLVLSGNLIKEAVRRLQRAVAAVAATGPASAPGPGGGRSGPDRIALQPSGSLL
Protein accession: AAH20165.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023401-B01-13-15-1.jpg
Application image note: Western Blot analysis of FRAT2 expression in transfected 293T cell line (H00023401-T01) by FRAT2 MaxPab polyclonal antibody.

Lane 1: FRAT2 transfected lysate(25.63 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FRAT2 MaxPab mouse polyclonal antibody (B01) now

Add to cart