Brand: | Abnova |
Reference: | H00023396-M10 |
Product name: | PIP5K1C monoclonal antibody (M10), clone 7D11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PIP5K1C. |
Clone: | 7D11 |
Isotype: | IgG2b Kappa |
Gene id: | 23396 |
Gene name: | PIP5K1C |
Gene alias: | KIAA0589|LCCS3|PIP5K-GAMMA|PIP5Kgamma |
Gene description: | phosphatidylinositol-4-phosphate 5-kinase, type I, gamma |
Genbank accession: | NM_012398 |
Immunogen: | PIP5K1C (NP_036530, 561 a.a. ~ 667 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RPQEEPPAEEDLQQITVQVEPACSVEIVVPKEEDAGVEASPAGASAAVEVETASQASDEEGAPASQASDEEDAPATDIYFPTDERSWVYSPLHYSAQAPPASDGESD |
Protein accession: | NP_036530 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.51 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PIP5K1C is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |