H00023395-M03_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA |
Brand: | Abnova |
Reference: | H00023395-M03 |
Product name: | LARS2 monoclonal antibody (M03), clone 3F12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LARS2. |
Clone: | 3F12 |
Isotype: | IgG2a Kappa |
Gene id: | 23395 |
Gene name: | LARS2 |
Gene alias: | KIAA0028|LEURS|MGC26121 |
Gene description: | leucyl-tRNA synthetase 2, mitochondrial |
Genbank accession: | NM_015340 |
Immunogen: | LARS2 (NP_056155, 806 a.a. ~ 903 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VPRKLCAHYTWDASVLLQAWPAVDPEFLQQPEVVQMAVLINNKACGKIPVPQQVARDQDKVHEFVLQSELGVRLLQGRSIKKSFLSPRTALINFLVQD |
Protein accession: | NP_056155 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |