LARS2 monoclonal antibody (M03), clone 3F12 View larger

LARS2 monoclonal antibody (M03), clone 3F12

H00023395-M03_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LARS2 monoclonal antibody (M03), clone 3F12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about LARS2 monoclonal antibody (M03), clone 3F12

Brand: Abnova
Reference: H00023395-M03
Product name: LARS2 monoclonal antibody (M03), clone 3F12
Product description: Mouse monoclonal antibody raised against a partial recombinant LARS2.
Clone: 3F12
Isotype: IgG2a Kappa
Gene id: 23395
Gene name: LARS2
Gene alias: KIAA0028|LEURS|MGC26121
Gene description: leucyl-tRNA synthetase 2, mitochondrial
Genbank accession: NM_015340
Immunogen: LARS2 (NP_056155, 806 a.a. ~ 903 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VPRKLCAHYTWDASVLLQAWPAVDPEFLQQPEVVQMAVLINNKACGKIPVPQQVARDQDKVHEFVLQSELGVRLLQGRSIKKSFLSPRTALINFLVQD
Protein accession: NP_056155
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy LARS2 monoclonal antibody (M03), clone 3F12 now

Add to cart