Brand: | Abnova |
Reference: | H00023370-M01 |
Product name: | ARHGEF18 monoclonal antibody (M01), clone 8H6 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant ARHGEF18. |
Clone: | 8H6 |
Isotype: | IgG2a Kappa |
Gene id: | 23370 |
Gene name: | ARHGEF18 |
Gene alias: | KIAA0521|MGC15913|P114-RhoGEF |
Gene description: | rho/rac guanine nucleotide exchange factor (GEF) 18 |
Genbank accession: | BC008016.1 |
Immunogen: | ARHGEF18 (AAH08016.1, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSQGMQRMHLETLQQVDKWPLCGPLACSELLQLTVRSLEGWRKEVLGSIKGAGTSQGGEIHPRSSSGGERAHVKPCSAPQALVVGLGPG |
Protein accession: | AAH08016.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.8 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ARHGEF18 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |