Brand: | Abnova |
Reference: | H00023368-Q01 |
Product name: | PPP1R13B (Human) Recombinant Protein (Q01) |
Product description: | Human PPP1R13B partial ORF (NP_056131.2, 1 a.a. - 90 a.a.) recombinant protein with GST tag at N-terminal. |
Gene id: | 23368 |
Gene name: | PPP1R13B |
Gene alias: | ASPP1|KIAA0771|p53BP2-like|p85 |
Gene description: | protein phosphatase 1, regulatory (inhibitor) subunit 13B |
Genbank accession: | NM_015316.2 |
Immunogen sequence/protein sequence: | MMPMILTVFLSNNEQILTEVPITPETTCRDVVEFCKEPGEGSCHLAEVWRGNERPIPFDHMMYEHLQKWGPRREEVKFFLRHEDSPTENS |
Protein accession: | NP_056131.2 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue |
Quality control testing picture: |  |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |