PSD3 MaxPab mouse polyclonal antibody (B01) View larger

PSD3 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PSD3 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about PSD3 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00023362-B01
Product name: PSD3 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human PSD3 protein.
Gene id: 23362
Gene name: PSD3
Gene alias: DKFZp761K1423|EFA6R|HCA67
Gene description: pleckstrin and Sec7 domain containing 3
Genbank accession: NM_206909.1
Immunogen: PSD3 (NP_996792.1, 1 a.a. ~ 513 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGSSWCLYGCCNAGVKTTRLEAHSEMGSTEILEKETPENLSNGTSSNVEAAKRLAKRLYQLDRFKRSDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVGETQERERVLIHFSNRYFYCNPDTIASQDGVHCLTCAIMLLNTDLHGHNIGKKMTCQEFIANLQGVNEGVDFSKDLLKALYNSIKNEKLEWAVDDEEKKKSPSESTEEKANGTHPKTISRIGSTTNPFLDIPHDPNAAVYKSGFLARKIHADMDGKKTPRGKRGWKTFYAVLKGTVLYLQKDEYKPEKALSEEDLKNAVSVHHALASKATDYEKKPNVFKLKTADWRVLLFQTQSPEEMQGWINKINCVAAVFSAPPFPAAIGSQKKFSRPLLPATTTKLSQEEQLKSHESKLKQITTELAEHRSYPPDKKVKAKDVDEYKLKDHYLEFEKTRYEMYVSILKEGGKELLSNDESEAAGLKKSHSSPSLNPDTSPITAKVKRNVSERKDHRPETPSIKQKVT
Protein accession: NP_996792.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023362-B01-13-15-1.jpg
Application image note: Western Blot analysis of PSD3 expression in transfected 293T cell line (H00023362-T01) by PSD3 MaxPab polyclonal antibody.

Lane1:PSD3 transfected lysate(56.43 KDa).
Lane2:Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PSD3 MaxPab mouse polyclonal antibody (B01) now

Add to cart