Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00023353-B02 |
Product name: | UNC84A MaxPab mouse polyclonal antibody (B02) |
Product description: | Mouse polyclonal antibody raised against a full-length human UNC84A protein. |
Gene id: | 23353 |
Gene name: | UNC84A |
Gene alias: | FLJ12407|KIAA0810|MGC176649|SUN1 |
Gene description: | unc-84 homolog A (C. elegans) |
Genbank accession: | BC013613 |
Immunogen: | UNC84A (AAH13613, 1 a.a. ~ 257 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MDFSRLHMYSPPQCVPENTGYTYALSSSYSSDALDFETEHKLDPVFDSPRMSRRSLRLATTACTLGDGEAVGADSGTSSAVSLKNRAARTTKQRRSTNKSAFSINHVSRQVTSSGVSHGGTVSLQDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGAAAATAHNGFSCSNCSMLSERKDVLTAHPAPPGPVSRVYSRDRNQKCKSQSFKTQKKVCFPNLIFPFCKSQCLHYLSWRLKIIP |
Protein accession: | AAH13613 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of UNC84A expression in transfected 293T cell line (H00023353-T02) by UNC84A MaxPab polyclonal antibody. Lane 1: UNC84A transfected lysate(28.27 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |