Brand: | Abnova |
Reference: | H00023336-M03A |
Product name: | DMN monoclonal antibody (M03A), clone 4G5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DMN. |
Clone: | 4G5 |
Isotype: | IgG1 Kappa |
Gene id: | 23336 |
Gene name: | SYNM |
Gene alias: | DMN|KIAA0353|SYN |
Gene description: | synemin, intermediate filament protein |
Genbank accession: | NM_145728 |
Immunogen: | DMN (NP_663780.1, 1466 a.a. ~ 1565 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VSNVEAIRSRTQEAGALGVSDRGSWRDADSRNDQAVGVSFKASAGEGDQAHREQGKEQAMFDKKVQLQRMVDQRSVISDEKKVALLYLDNEEEENDGHWF |
Protein accession: | NP_663780.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |