Brand: | Abnova |
Reference: | H00023332-M02 |
Product name: | CLASP1 monoclonal antibody (M02), clone 6A11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CLASP1. |
Clone: | 6A11 |
Isotype: | IgG1 Kappa |
Gene id: | 23332 |
Gene name: | CLASP1 |
Gene alias: | DKFZp686D1968|DKFZp686H2039|FLJ33821|FLJ41222|KIAA0622|MAST1|MGC131895 |
Gene description: | cytoplasmic linker associated protein 1 |
Genbank accession: | NM_015282 |
Immunogen: | CLASP1 (NP_056097, 1133 a.a. ~ 1226 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DGLAKHPPPFSQPNSIPTAPSHKALRRSYSPSMLDYDTENLNSEEIYSSLRGVTEAIEKFSFRSQEDLNEPIKRDGKKECDIVSRDGGAASPAT |
Protein accession: | NP_056097 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.08 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CLASP1 is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |