Brand: | Abnova |
Reference: | H00023328-A01 |
Product name: | SASH1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant SASH1. |
Gene id: | 23328 |
Gene name: | SASH1 |
Gene alias: | KIAA0790|RP3-323M4.1|SH3D6A|dJ323M4|dJ323M4.1 |
Gene description: | SAM and SH3 domain containing 1 |
Genbank accession: | NM_015278 |
Immunogen: | SASH1 (NP_056093, 1066 a.a. ~ 1175 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | ENTSLQEHGVKLGPALTRKVSCARGVDLETLTENKLHAEGIDLTEEPYSDKHGRCGIPEALVQRYAEDLDQPERDVAANMDQIRVKQLRKQHRMAIPSGGLTEICRKPVS |
Protein accession: | NP_056093 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |