Brand: | Abnova |
Reference: | H00023327-M04 |
Product name: | NEDD4L monoclonal antibody (M04), clone 1D2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NEDD4L. |
Clone: | 1D2 |
Isotype: | IgG2a Kappa |
Gene id: | 23327 |
Gene name: | NEDD4L |
Gene alias: | FLJ33870|KIAA0439|NEDD4-2|RSP5|hNedd4-2 |
Gene description: | neural precursor cell expressed, developmentally down-regulated 4-like |
Genbank accession: | BC032597 |
Immunogen: | NEDD4L (AAH32597, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLT |
Protein accession: | AAH32597 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of NEDD4L transfected lysate using anti-NEDD4L monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NEDD4L monoclonal antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |