ZCCHC11 purified MaxPab mouse polyclonal antibody (B01P) View larger

ZCCHC11 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZCCHC11 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about ZCCHC11 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00023318-B01P
Product name: ZCCHC11 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human ZCCHC11 protein.
Gene id: 23318
Gene name: ZCCHC11
Gene alias: PAPD3
Gene description: zinc finger, CCHC domain containing 11
Genbank accession: BC048301.1
Immunogen: ZCCHC11 (AAH48301.1, 1 a.a. ~ 309 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEESKTLKSENHEPKKNVICEESKAVQVIGNQTLKARNDKSVKEIENSSPNRNSSKKNKQNDICIEKTEVKSCKVNAANLPGPKDLGLVLRDQSHCKAKKFPNSPVKAEKATISQAKSEKATSLQAIAEKSPKSPNSVKAEKASSYQMKSEKVPSSPAEAEKGPSLLLKDMRQKTELQQIGKKIPSSFTSVDKVNIEAVGGEKCALQNSPRSQKQQTCTDNTGDSDDSASGIEDVSDDLSKMKNDESNKENSSEMDYLENATVIDESALTPEQRLGLKQAEERLERDHIFRLEKVYYVVLVIWGEMCVS
Protein accession: AAH48301.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023318-B01P-13-15-1.jpg
Application image note: Western Blot analysis of ZCCHC11 expression in transfected 293T cell line (H00023318-T01) by ZCCHC11 MaxPab polyclonal antibody.

Lane 1: ZCCHC11 transfected lysate(33.99 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZCCHC11 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart