Brand: | Abnova |
Reference: | H00023316-M03 |
Product name: | CUX2 monoclonal antibody (M03), clone 2H8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CUX2. |
Clone: | 2H8 |
Isotype: | IgG1 Kappa |
Gene id: | 23316 |
Gene name: | CUX2 |
Gene alias: | CDP2|CUTL2 |
Gene description: | cut-like homeobox 2 |
Genbank accession: | NM_015267 |
Immunogen: | CUX2 (NP_056082.1, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FDPSGQPRRDLHTSWKRNPELLSPKEQREGTSPAGPTLTEGSRLPGIPGKALLTETLLQRNEAEKQKGLQEVQITLAARLGEAEEKIKVLHSALKATQAE |
Protein accession: | NP_056082.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CUX2 monoclonal antibody (M03), clone 2H8. Western Blot analysis of CUX2 expression in HepG2. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Automated Immunohistochemical Method to Analyze Large Areas of the Human Cortex.Abbass M, Trought K, Long D, Semechko A, Wong AHC. J Neurosci Methods. 2017 Nov 7;294:81-90. |