Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of KIAA0056 monoclonal antibody (M01), clone 1D5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,ELISA,WB-Re |
More info about KIAA0056 monoclonal antibody (M01), clone 1D5
| Brand: | Abnova |
| Reference: | H00023310-M01 |
| Product name: | KIAA0056 monoclonal antibody (M01), clone 1D5 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant KIAA0056. |
| Clone: | 1D5 |
| Isotype: | IgG1 kappa |
| Gene id: | 23310 |
| Gene name: | NCAPD3 |
| Gene alias: | CAP-D3|FLJ42888|KIAA0056|MGC104671|hCAP-D3|hHCP-6|hcp-6 |
| Gene description: | non-SMC condensin II complex, subunit D3 |
| Genbank accession: | BC011408.1 |
| Immunogen: | KIAA0056 (AAH11408.1, 1 a.a. ~ 341 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MRSKPDKDLLMEEDDMALANVVMQEAQKKLISQVQKRNFIENIIPIIISLKTVLEKNKIPALRELMHYLREVMQDYRDELKDFFAVDKQLASELEYDMKKYQEQLVQEQELAKHADVAGTAGGAEVAPVAQVALCLETVPVPAGQENPAMSPAVSQPCTPRASAGHVAVSSPTPETGPLQRLLPKARPMSLSTIAILNSVKKAVESKSRHRSRSLGVLPFTLNSGSPEKTCSQVSSYSLEQESNGEIEHVTKRAI |
| Protein accession: | AAH11408.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (63.51 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to KIAA0056 on formalin-fixed paraffin-embedded human breast cancer tissue.[antibody concentration 2 ug/ml] |
| Applications: | WB-Ce,IHC-P,ELISA,WB-Re |
| Shipping condition: | Dry Ice |