ICOSLG monoclonal antibody (M08), clone 1F1 View larger

ICOSLG monoclonal antibody (M08), clone 1F1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ICOSLG monoclonal antibody (M08), clone 1F1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ICOSLG monoclonal antibody (M08), clone 1F1

Brand: Abnova
Reference: H00023308-M08
Product name: ICOSLG monoclonal antibody (M08), clone 1F1
Product description: Mouse monoclonal antibody raised against a partial recombinant ICOSLG.
Clone: 1F1
Isotype: IgG1 Kappa
Gene id: 23308
Gene name: ICOSLG
Gene alias: B7-H2|B7H2|B7RP-1|B7RP1|CD275|GL50|ICOS-L|ICOSL|KIAA0653|LICOS
Gene description: inducible T-cell co-stimulator ligand
Genbank accession: BC064637.1
Immunogen: ICOSLG (AAH64637.1, 18 a.a. ~ 135 a.a) partial recombinant protein.
Immunogen sequence/protein sequence: ADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVA
Protein accession: AAH64637.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023308-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (15.18 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ICOSLG monoclonal antibody (M08), clone 1F1 now

Add to cart