Brand: | Abnova |
Reference: | H00023308-M05 |
Product name: | ICOSLG monoclonal antibody (M05), clone 3H8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ICOSLG. |
Clone: | 3H8 |
Isotype: | IgG1 Kappa |
Gene id: | 23308 |
Gene name: | ICOSLG |
Gene alias: | B7-H2|B7H2|B7RP-1|B7RP1|CD275|GL50|ICOS-L|ICOSL|KIAA0653|LICOS |
Gene description: | inducible T-cell co-stimulator ligand |
Genbank accession: | BC064637.1 |
Immunogen: | ICOSLG (AAH64637.1, 18 a.a. ~ 256 a.a) partial recombinant protein. |
Immunogen sequence/protein sequence: | ADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAAT |
Protein accession: | AAH64637.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |