UBR2 monoclonal antibody (M01), clone 4G4 View larger

UBR2 monoclonal antibody (M01), clone 4G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBR2 monoclonal antibody (M01), clone 4G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about UBR2 monoclonal antibody (M01), clone 4G4

Brand: Abnova
Reference: H00023304-M01
Product name: UBR2 monoclonal antibody (M01), clone 4G4
Product description: Mouse monoclonal antibody raised against a partial recombinant UBR2.
Clone: 4G4
Isotype: IgG2a Kappa
Gene id: 23304
Gene name: UBR2
Gene alias: C6orf133|DKFZp686C08114|KIAA0349|MGC71112|RP3-392M17.3|bA49A4.1|dJ242G1.1|dJ392M17.3
Gene description: ubiquitin protein ligase E3 component n-recognin 2
Genbank accession: NM_015255
Immunogen: UBR2 (NP_056070, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLTREVYQHLAHYVPKIYCRGPNPFPQKEDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCG
Protein accession: NP_056070
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023304-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023304-M01-13-15-1.jpg
Application image note: Western Blot analysis of UBR2 expression in transfected 293T cell line by UBR2 monoclonal antibody (M01), clone 4G4.

Lane 1: UBR2 transfected lysate(50 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy UBR2 monoclonal antibody (M01), clone 4G4 now

Add to cart