Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of AGTPBP1 monoclonal antibody (M03), clone 2B9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about AGTPBP1 monoclonal antibody (M03), clone 2B9
| Brand: | Abnova |
| Reference: | H00023287-M03 |
| Product name: | AGTPBP1 monoclonal antibody (M03), clone 2B9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant AGTPBP1. |
| Clone: | 2B9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 23287 |
| Gene name: | AGTPBP1 |
| Gene alias: | DKFZp686M20191|KIAA1035|NNA1 |
| Gene description: | ATP/GTP binding protein 1 |
| Genbank accession: | NM_015239 |
| Immunogen: | AGTPBP1 (NP_056054, 1087 a.a. ~ 1186 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GAKFCVGLLRLKRLTSPLEYNLPSSLLDFENDLIESSCKVTSPTTYVLDEDEPRFLEEVDYSAESNDELDIELAENVGDYEPSAQEEVLSDSELSRTYLP |
| Protein accession: | NP_056054 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | AGTPBP1 monoclonal antibody (M03), clone 2B9. Western Blot analysis of AGTPBP1 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |