TSPYL4 purified MaxPab mouse polyclonal antibody (B01P) View larger

TSPYL4 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TSPYL4 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about TSPYL4 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00023270-B01P
Product name: TSPYL4 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human TSPYL4 protein.
Gene id: 23270
Gene name: TSPYL4
Gene alias: KIAA0721|dJ486I3.2
Gene description: TSPY-like 4
Genbank accession: BC009116.1
Immunogen: TSPYL4 (AAH09116.1, 1 a.a. ~ 211 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDSLEAIDQELSNVNAQADRAFLQLERKFGRMRRLHMQRRSFIIQNIPGFWVTAFRNHPQLSPMISGQDEDMLRYMINLEVEELKHPRAGCKFKFIFQGNPYFRNEGLVKEYERRSSGRVVSLSTPIRWHRGQDPQAHIHRNREGNTIPSFFNWFSDHSLLEFDRIAEIIKGELWPNPLQYYLMGEGPRRGIRGPPRQPVESARSFRFQSG
Protein accession: AAH09116.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023270-B01P-13-15-1.jpg
Application image note: Western Blot analysis of TSPYL4 expression in transfected 293T cell line (H00023270-T01) by TSPYL4 MaxPab polyclonal antibody.

Lane 1: TSPYL4 transfected lysate(23.21 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TSPYL4 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart