DNMBP monoclonal antibody (M01C), clone 1H2 View larger

DNMBP monoclonal antibody (M01C), clone 1H2

H00023268-M01C_200uL

New product

395,00 € tax excl.

200 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DNMBP monoclonal antibody (M01C), clone 1H2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about DNMBP monoclonal antibody (M01C), clone 1H2

Brand: Abnova
Reference: H00023268-M01C
Product name: DNMBP monoclonal antibody (M01C), clone 1H2
Product description: Mouse monoclonal antibody raised against a partial recombinant DNMBP.
Clone: 1H2
Isotype: IgG3 Kappa
Gene id: 23268
Gene name: DNMBP
Gene alias: KIAA1010|TUBA
Gene description: dynamin binding protein
Genbank accession: BC041628
Immunogen: DNMBP (AAH41628, 491 a.a. ~ 590 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TKKPFERKTIDRQSARKPLLGLPSYMLQSEELRASLLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTKGFVYSSFLK
Protein accession: AAH41628
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023268-M01C-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DNMBP monoclonal antibody (M01C), clone 1H2 now

Add to cart