EXOC7 monoclonal antibody (M01), clone 1D4 View larger

EXOC7 monoclonal antibody (M01), clone 1D4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EXOC7 monoclonal antibody (M01), clone 1D4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about EXOC7 monoclonal antibody (M01), clone 1D4

Brand: Abnova
Reference: H00023265-M01
Product name: EXOC7 monoclonal antibody (M01), clone 1D4
Product description: Mouse monoclonal antibody raised against a partial recombinant EXOC7.
Clone: 1D4
Isotype: IgG2a Kappa
Gene id: 23265
Gene name: EXOC7
Gene alias: 2-5-3p|DKFZp686J04253|EX070|EXO70|EXOC1|Exo70p|FLJ40965|FLJ46415|YJL085W
Gene description: exocyst complex component 7
Genbank accession: NM_001013839
Immunogen: EXOC7 (NP_001013861, 586 a.a. ~ 684 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VFQPGVKLRDKERQIIKERFKGFNDGLEELCKIQKAWAIPDTEQRDRIRQAQKTIVKETYGAFLQKFGSVPFTKNPEKYIKYGVEQVGDMIDRLFDTSA
Protein accession: NP_001013861
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023265-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023265-M01-3-36-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to EXOC7 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EXOC7 monoclonal antibody (M01), clone 1D4 now

Add to cart