SCC-112 MaxPab mouse polyclonal antibody (B01) View larger

SCC-112 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SCC-112 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about SCC-112 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00023244-B01
Product name: SCC-112 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human SCC-112 protein.
Gene id: 23244
Gene name: PDS5A
Gene alias: DKFZp686B19246|FLJ41012|KIAA0648|MGC131948|MGC161503|PIG54|SCC-112
Gene description: PDS5, regulator of cohesion maintenance, homolog A (S. cerevisiae)
Genbank accession: BC009650.1
Immunogen: SCC-112 (AAH09650.1, 1 a.a. ~ 333 a.a) full-length human protein.
Immunogen sequence/protein sequence: MIHLLAHDPDFTRSQDVDQLRDIKECLWFMLEVLMTKNENNSHAFMKKMAENIKLTRDAQSPDESKTNEKLYTVCDVALCVINSKSALCNADSPKDPVLPMKFFTQPEKDFCNDKSYISEETRVLLLTGKPKPAGVLGAVNKPLSATGRKPYVRSTGTETGSNINVNSELNPSTGNRSREQSSEAAETGVSENEENPVRIISVTPVKNIDPVKNKEINSDQATQGNISSDRGKKRTVTAAGAENIQQKTDEKVDESGPPAPSKPRRGRRPKSESQGNATKNDDLNKPINKGRKRAAVGQESPGGLEAGNAKAPKLQDLAKKAAPAERQIDLQR
Protein accession: AAH09650.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023244-B01-13-15-1.jpg
Application image note: Western Blot analysis of PDS5A expression in transfected 293T cell line (H00023244-T01) by PDS5A MaxPab polyclonal antibody.

Lane 1: SCC-112 transfected lysate(36.63 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SCC-112 MaxPab mouse polyclonal antibody (B01) now

Add to cart