Brand: | Abnova |
Reference: | H00023228-M02 |
Product name: | PLCL2 monoclonal antibody (M02), clone 1C7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PLCL2. |
Clone: | 1C7 |
Isotype: | IgG2a Kappa |
Gene id: | 23228 |
Gene name: | PLCL2 |
Gene alias: | FLJ13484|KIAA1092|PLCE2 |
Gene description: | phospholipase C-like 2 |
Genbank accession: | BC036392 |
Immunogen: | PLCL2 (AAH36392, 121 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RYLISYGKHTLDMLESSQDNMRTSWVSQMFSEIDVDNLGHITLCNAVQCIRNLNPGLKTSKIELKFKELHKSKDKAGTEVTKEEFIEVFH |
Protein accession: | AAH36392 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of PLCL2 transfected lysate using anti-PLCL2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PLCL2 monoclonal antibody. |
Applications: | ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |