Brand: | Abnova |
Reference: | H00023219-A01 |
Product name: | FBXO28 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant FBXO28. |
Gene id: | 23219 |
Gene name: | FBXO28 |
Gene alias: | FLJ10766|Fbx28|KIAA0483 |
Gene description: | F-box protein 28 |
Genbank accession: | NM_015176 |
Immunogen: | FBXO28 (NP_055991, 191 a.a. ~ 290 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | QRAHEVLQELRDISSMAMEYFDEKIVPILKRKLPGSDVSGRLMGSPPVPGPSAALTTMQLFSKQNPSRQEVTKLQQQVKTNGAGVTVLRREISELRTKVQ |
Protein accession: | NP_055991 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | FBXO28 polyclonal antibody (A01), Lot # 051102JC01 Western Blot analysis of FBXO28 expression in MES-SA/Dx5 ( Cat # L021V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |