Brand: | Abnova |
Reference: | H00023204-M09 |
Product name: | ARL6IP monoclonal antibody (M09), clone 4F9 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant ARL6IP. |
Clone: | 4F9 |
Isotype: | IgG2a Kappa |
Gene id: | 23204 |
Gene name: | ARL6IP1 |
Gene alias: | AIP1|ARL6IP|ARMER|KIAA0069 |
Gene description: | ADP-ribosylation factor-like 6 interacting protein 1 |
Genbank accession: | BC010281 |
Immunogen: | ARL6IP (AAH10281, 1 a.a. ~ 203 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE |
Protein accession: | AAH10281 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |